PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla018977
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family CO-like
Protein Properties Length: 354aa    MW: 41339.5 Da    PI: 4.8697
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla018977genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.21.6e-08648339
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
               +r+C+ +  k++++fC  ++ +lC++C ++ H+       H++
  Cla018977  6 ARVCDSCLCKRARWFCAADDAFLCQTCDVSVHSAnqlarrHDR 48
               689*****************************65677777776 PP

2CCT68.22.2e-23306349144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                Rea+++RY+eKr+tR+F+KkirY++RK +Ae+RpR+KGrFvk++
  Cla018977 306 REARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRMKGRFVKRT 349
                9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011911.007451IPR000315B-box-type zinc finger
SMARTSM003368.8E-10451IPR000315B-box-type zinc finger
PfamPF006435.9E-8649IPR000315B-box-type zinc finger
CDDcd000213.10E-8739No hitNo description
PfamPF062036.0E-18306348IPR010402CCT domain
PROSITE profilePS5101716.043306348IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MGGRTARVCD SCLCKRARWF CAADDAFLCQ TCDVSVHSAN QLARRHDRIR LETASFNSTN  60
NQSQSNLPPW LNGFTRKART PRPKISSTKA SVFSLVPEIG NDNEGFSVDE NDDEQHQFLN  120
HHQQEVPVFD PLFDDQKFLL THELEDFGDG FLPSEVDLAE FVADVENLLG RQEEEQEQEQ  180
ENDENTVIFK VKSEDQLVQD CINNNNNNGF LMDWNFKGEE IEEDEMNKVE EELKINNNNK  240
KNISLRLNYD AVITAWDDQS SPYTTGNRPE FDLDDCWEEW SGWGFLEESN GGKWGGREEW  300
KNNGEREARV SRYREKRRTR LFSKKIRYQV RKLNAEKRPR MKGRFVKRTT THNH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1316332RRTRLFSKKIRYQVRKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453390.11e-173PREDICTED: zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A0A0LSN31e-169A0A0A0LSN3_CUCSA; Uncharacterized protein
STRINGPOPTR_0015s06480.14e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73870.15e-62B-box type zinc finger protein with CCT domain